PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02499.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 371aa    MW: 39579.7 Da    PI: 8.2288
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02499.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.1e-3970129362
                   zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                              ++ +kcprC+s++tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk s
  Rsa1.0_02499.1_g00003.1  70 DHPQKCPRCESAHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKPS 129
                              6789*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3458123IPR003851Zinc finger, Dof-type
PfamPF027011.5E-3271127IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.64973127IPR003851Zinc finger, Dof-type
PROSITE patternPS01361075111IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MGLTSLQVCM DSDWLQEAES SGGSMLDSTT TSPTAAEILA ACSTRPQASA MAVAAAALMD  60
GGRRLRPPHD HPQKCPRCES AHTKFCYYNN YSLSQPRYFC KTCRRYWTKG GTLRNIPVGG  120
GCRKNKKPSS SNSSSSTSSG KKPSNIVTTN TNDLMALVHS HQNYQNASLG FSHFGGNGVM  180
GSYTALGHSN VGFLESKYGG LLSPSPRPIE FLDSKFDLVG VNNDNLVMVD HGSNGDRHHH  240
QMGMNHGLGL NNNNNDGFQG ISPASNGNAG GGLMDLSISQ RLMLANYDHH HYNHHEDNQR  300
VTSIMDVKPT PKLLSLDWQQ GQGYTDGSGN GGGGRSDGGA YGGSGYINGL GSTWNGLMNG  360
YGSSTKTNSM V
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013721023.10.0PREDICTED: dof zinc finger protein DOF5.6-like isoform X1
SwissprotQ9FM031e-165DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLA0A078EGU00.0A0A078EGU0_BRANA; BnaA06g22420D protein
STRINGBra010136.1-P1e-180(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63742746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.11e-144Dof family protein